Structure of PDB 8bh6 Chain j

Receptor sequence
>8bh6j (length=102) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
MAKQKIRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYT
IIRAVHMYKDSREQFEQRTHKRLIDIVNPTPKTVDALMGLNLPSGVDIEI
KL
3D structure
PDB8bh6 Ribosome maturation factor P (RimP) from Staphylococcus aureus
Chainj
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j M1 R7 R9 K11 H15 R16 S37 G38 P39 I40 P41 L42 P43 T44 T50 R53 A54 H56 M57 Y58 K59 S61 R62 Q64 H70 L73 D75 M1 R7 R9 K11 H15 R16 S37 G38 P39 I40 P41 L42 P43 T44 T50 R53 A54 H56 M57 Y58 K59 S61 R62 Q64 H70 L73 D75
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bh6, PDBe:8bh6, PDBj:8bh6
PDBsum8bh6
PubMed
UniProtQ931G5|RS10_STAAM Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]