Structure of PDB 8asp Chain j

Receptor sequence
>8aspj (length=40) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP
3D structure
PDB8asp The Ycf48 accessory factor occupies the site of the oxygen-evolving manganese cluster during photosystem II biogenesis.
Chainj
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA j A11 P12 A11 P12
BS02 CLA j F29 D35 L36 L37 F29 D35 L36 L37
BS03 ZEX j H39 P40 H39 P40
BS04 CLA j M14 I15 M14 I15
BS05 CLA j L18 T22 L18 T22
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8asp, PDBe:8asp, PDBj:8asp
PDBsum8asp
PubMed37542031
UniProtQ55329|PSAJ_SYNY3 Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]