Structure of PDB 7zme Chain j |
>7zmej (length=73) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] |
GLQHYKIAMDPALVRLGSMISNRYKYFRWTKRTALVSFMYVVVVPSTIGY LAYKTDGLWDLRAKRRGDLISER |
|
PDB | 7zme Conformational changes in mitochondrial complex I of the thermophilic eukaryote Chaetomium thermophilum. |
Chain | j |
Resolution | 2.83 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
LMN |
j |
L60 W61 I72 |
L58 W59 I70 |
|
|
|
|