Structure of PDB 7z34 Chain j

Receptor sequence

>7z34j (length=85) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGA
KAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSASKA

3D structure

PDB

7z34 Visualizing maturation factor extraction from the nascent ribosome by the AAA-ATPase Drg1.

Chain

Resolution

3.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	K3 T5 F8 G9 K10 R11 H12 N13 K14 H16 Q30 K31 S35 K43 T44 R45 N48 W49 K52 R55 K75 Q79	K2 T4 F7 G8 K9 R10 H11 N12 K13 H15 Q29 K30 S34 K42 T43 R44 N47 W48 K51 R54 K74 Q78
BS02	rna	j	T17 R21 C22 F27 V29 Y39 G62 R63 M64 R65 Y66 L67 R72 R73 F74 N76 Q79 G81 S82 A83 K85	T16 R20 C21 F26 V28 Y38 G61 R62 M63 R64 Y65 L66 R71 R72 F73 N75 Q78 G80 S81 A82 K84

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7z34, PDBe:7z34, PDBj:7z34
PDBsum	7z34
PubMed	36097293
UniProt	P49166\|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)