Structure of PDB 7vxs Chain j

Receptor sequence

>7vxsj (length=115) Species: 9823 (Sus scrofa)

MNIMLTLLTNVTLASLLVLIAFWLPQLNAYSEKTSPYECGFDPMGSARLP
FSMKFFLVAITFLLFDLEIALLLPLPWASQTNNLKTMLTMALFLLILLAA
SLAYEWTQKGLEWAE

3D structure

• PDB: 7vxs The coupling mechanism of mammalian mitochondrial complex I.
• Chain: j
• Resolution: 2.9 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PLX	j	L16 W23 L24 P25	L16 W23 L24 P25
BS02	PLX	j	N83 F93	N83 F93

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity

Biological Process

• GO:0006120 mitochondrial electron transport, NADH to ubiquinone
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:7vxs, PDBe:7vxs, PDBj:7vxs
• PDBsum: 7vxs
• PubMed: 35145322
• UniProt: O79880|NU3M_PIG NADH-ubiquinone oxidoreductase chain 3 (Gene Name=MT-ND3)