Structure of PDB 7umh Chain j

Receptor sequence
>7umhj (length=39) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFH
3D structure
PDB7umh Energetic robustness to large scale structural fluctuations in a photosynthetic supercomplex.
Chainj
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA j A11 P12 I15 L19 A11 P12 I15 L19
BS02 CLA j M16 A17 M16 A17
BS03 CLA j M14 I15 L18 M14 I15 L18
BS04 CLA j M16 L19 T20 A23 M16 L19 T20 A23
BS05 CLA j D35 L36 L37 D35 L36 L37
BS06 CLA j L18 T22 L18 T22
BS07 CLA j F21 G24 E28 R31 F21 G24 E28 R31
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7umh, PDBe:7umh, PDBj:7umh
PDBsum7umh
PubMed37532717
UniProtQ55329|PSAJ_SYNY3 Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]