Structure of PDB 7pjt Chain j

Receptor sequence
>7pjtj (length=98) Species: 562 (Escherichia coli) [Search protein sequence]
RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLIS
PHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL
3D structure
PDB7pjt Structural mechanism of GTPase-powered ribosome-tRNA movement.
Chainj
Resolution6.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j R7 R9 H15 D19 R37 G38 P39 I40 P41 P43 T44 L52 S54 P55 H56 V57 N58 K59 R62 Q64 R68 H70 R72 R3 R5 H11 D15 R33 G34 P35 I36 P37 P39 T40 L48 S50 P51 H52 V53 N54 K55 R58 Q60 R64 H66 R68
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pjt, PDBe:7pjt, PDBj:7pjt
PDBsum7pjt
PubMed34635670
UniProtC3SQT7

[Back to BioLiP]