Structure of PDB 7pas Chain j

Receptor sequence
>7pasj (length=122) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
MVSFMTRLNVADNTGAKQVGIIKVLGSTRKRYAFLGDVVVVSVKDAIPSG
MVKKGQVLRAVIVRTKKGQQRKDGTHLKFDDNACVLIKEDKSPRGTRIFG
PVARELRERGYNKILSLAVEVV
3D structure
PDB7pas Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainj
Resolution16.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j M1 S3 F4 M5 T6 R7 I22 K23 L25 G26 S27 T28 R29 K30 R31 Y32 F34 V40 S42 K44 K54 V57 K66 K67 Q69 Q70 H76 K78 N82 R109 M1 S3 F4 M5 T6 R7 I22 K23 L25 G26 S27 T28 R29 K30 R31 Y32 F34 V40 S42 K44 K54 V57 K66 K67 Q69 Q70 H76 K78 N82 R109
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pas, PDBe:7pas, PDBj:7pas
PDBsum7pas
PubMed36171285
UniProtQ50308|RL14_MYCPN Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]