Structure of PDB 7p7r Chain j

Receptor sequence

>7p7rj (length=127) Species: 226185 (Enterococcus faecalis V583)

VQYSGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLREVINQPFG
VTETKGAYDVIVNVNGGGYAGQSGAIRHGIARALLQVDPDFRSALKRAGL
LTRDARMVERKKPGLKKARKASQFSKR

3D structure

• PDB: 7p7r Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.
• Chain: j
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	K129 R130	K126 R127
BS02	rna	j	Q5 T9 R11 R12 K13 N14 V16 R18 Y38 P40 N68 G69 G70 G71 Y72 A73 Q75 R85 R95 K99 T105 R106 R109 M110 V111 E112 R113 K114 K115 P116 G117 K119 K120 R122 K123 A124 S125 Q126 F127 K129	Q2 T6 R8 R9 K10 N11 V13 R15 Y35 P37 N65 G66 G67 G68 Y69 A70 Q72 R82 R92 K96 T102 R103 R106 M107 V108 E109 R110 K111 K112 P113 G114 K116 K117 R119 K120 A121 S122 Q123 F124 K126

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7p7r, PDBe:7p7r, PDBj:7p7r
• PDBsum: 7p7r
• PubMed: 35387982
• UniProt: Q82Z47|RS9_ENTFA Small ribosomal subunit protein uS9 (Gene Name=rpsI)