Structure of PDB 7ohu Chain j

Receptor sequence

>7ohuj (length=71) Species: 559292 (Saccharomyces cerevisiae S288C)

SHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKRRHTTGTGRM
RYLKHVSRRFKNGFQTGSASK

3D structure

• PDB: 7ohu Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
• Chain: j
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	H16 R24 S26 H28 K31 S35 A42 K43 T44 R45 Y47 N48 W49 K52 R55 R56	H2 R10 S12 H14 K17 S21 A28 K29 T30 R31 Y33 N34 W35 K38 R41 R42
BS02	rna	j	N20 R21 C22 T59 G60 G62 R63 M64 R65 Y66 L67 K68 R72 F74 N76 Q79 T80 G81 A83 K85	N6 R7 C8 T45 G46 G48 R49 M50 R51 Y52 L53 K54 R58 F60 N62 Q65 T66 G67 A69 K71
BS03	ZN	j	C19 C34 C37	C5 C20 C23

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ohu, PDBe:7ohu, PDBj:7ohu
• PDBsum: 7ohu
• PubMed: 34813592
• UniProt: P49166|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)