Structure of PDB 7og4 Chain j

Receptor sequence
>7og4j (length=86) Species: 9606 (Homo sapiens) [Search protein sequence]
AGGQWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAERET
FARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENA
3D structure
PDB7og4 Structural basis of mitochondrial translation.
Chainj
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j A23 G24 Q26 N36 S38 G39 T44 M60 K61 G62 R65 R66 A1 G2 Q4 N14 S16 G17 T22 M38 K39 G40 R43 R44
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7og4, PDBe:7og4, PDBj:7og4
PDBsum7og4
PubMed32812867
UniProtQ86TS9|RM52_HUMAN Large ribosomal subunit protein mL52 (Gene Name=MRPL52)

[Back to BioLiP]