Structure of PDB 7of1 Chain j

Receptor sequence

>7of1j (length=85) Species: 559292 (Saccharomyces cerevisiae S288C)

GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGA
KAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSASKA

3D structure

• PDB: 7of1 Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
• Chain: j
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	G2 K3 G4 T5 S7 F8 G9 K10 R11 H12 N13 K14 S15 H16 R24 H28 Q30 K31 S35 S36 K43 T44 R45 Y47 N48 W49 K52 A53 R55 R56	G1 K2 G3 T4 S6 F7 G8 K9 R10 H11 N12 K13 S14 H15 R23 H27 Q29 K30 S34 S35 K42 T43 R44 Y46 N47 W48 K51 A52 R54 R55
BS02	rna	j	N20 R21 C22 F27 T59 G62 R63 M64 R65 Y66 L67 K68 H69 R72 F74 N76 F78 Q79 T80 G81 A83 K85	N19 R20 C21 F26 T58 G61 R62 M63 R64 Y65 L66 K67 H68 R71 F73 N75 F77 Q78 T79 G80 A82 K84

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7of1, PDBe:7of1, PDBj:7of1
• PDBsum: 7of1
• PubMed: 34813592
• UniProt: P49166|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)