Structure of PDB 7odr Chain j

Receptor sequence
>7odrj (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
AGGQWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAERET
FARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASL
3D structure
PDB7odr Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
Chainj
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j A23 G24 G25 A35 N36 P37 S38 M60 K61 G62 R65 R66 A1 G2 G3 A13 N14 P15 S16 M38 K39 G40 R43 R44
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7odr, PDBe:7odr, PDBj:7odr
PDBsum7odr
PubMed34135320
UniProtQ86TS9|RM52_HUMAN Large ribosomal subunit protein mL52 (Gene Name=MRPL52)

[Back to BioLiP]