Structure of PDB 7nhm Chain j

Receptor sequence

>7nhmj (length=127) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

VEYRGTGRRKNSVARVRLVPGEGNITVNNRDVREYLPFESLILDLNQPFD
VTETKGNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGL
LTRDPRMKERKKPGLKAARRSPQFSKR

3D structure

PDB

7nhm Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	T11 R13 R14 K15 N16 V18 R20 R22 N68 H70 G71 G72 G73 F74 T75 G76 Q77 R87 R97 K101 T107 R108 R111 K113 E114 R115 K116 K117 P118 G119 K121 R124 R125 S126 Q128 F129 S130 R132	T6 R8 R9 K10 N11 V13 R15 R17 N63 H65 G66 G67 G68 F69 T70 G71 Q72 R82 R92 K96 T102 R103 R106 K108 E109 R110 K111 K112 P113 G114 K116 R119 R120 S121 Q123 F124 S125 R127
BS02	rna	j	K131 R132	K126 R127

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7nhm, PDBe:7nhm, PDBj:7nhm
PDBsum	7nhm
PubMed	34117249
UniProt	Q2FW39\|RS9_STAA8 Small ribosomal subunit protein uS9 (Gene Name=rpsI)