Structure of PDB 7nac Chain j

Receptor sequence

>7nacj (length=73) Species: 1247190 (Saccharomyces cerevisiae BY4741)

KSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKRRHTTGTGR
MRYLKHVSRRFKNGFQTGSASKA

3D structure

• PDB: 7nac Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
• Chain: j
• Resolution: 3.04 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	S15 H16 R24 S26 H28 Q30 K31 S35 K43 T44 R45 Y47 N48 W49 K52 R55 R56	S2 H3 R11 S13 H15 Q17 K18 S22 K30 T31 R32 Y34 N35 W36 K39 R42 R43
BS02	rna	j	K14 R21 C22 G23 K32 T59 G60 T61 G62 R63 M64 R65 Y66 L67 K68 V70 S71 R72 F74 N76 Q79 T80 G81 A83 K85	K1 R8 C9 G10 K19 T46 G47 T48 G49 R50 M51 R52 Y53 L54 K55 V57 S58 R59 F61 N63 Q66 T67 G68 A70 K72
BS03	ZN	j	C19 C22 C34	C6 C9 C21

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7nac, PDBe:7nac, PDBj:7nac
• PDBsum: 7nac
• PubMed: 36482249
• UniProt: P49166|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)