Structure of PDB 7m4u Chain j

Receptor sequence
>7m4uj (length=100) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
NQRIRIRLKSFDHRLIDQSAQEIVETAKRTGAQVCGPIPMPTRIERFNVL
TSPHVNKDARDQYEIRTYKRLIDIVQPTDKTVDALMKLDLAAGVDVQIAL
3D structure
PDB7m4u Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.
Chainj
Resolution2.71 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j R7 K11 H15 G38 P39 I40 P41 M42 P43 R45 N50 T53 S54 P55 H56 N58 K59 A61 R62 Q64 Y70 K71 R72 R5 K9 H13 G36 P37 I38 P39 M40 P41 R43 N48 T51 S52 P53 H54 N56 K57 A59 R60 Q62 Y68 K69 R70
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7m4u, PDBe:7m4u, PDBj:7m4u
PDBsum7m4u
PubMed34044590
UniProtB7IA40|RS10_ACIB5 Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]