Structure of PDB 7dco Chain j

Receptor sequence
>7dcoj (length=70) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
PVNPKPFLKGLVNHRVGVKLKSTEYRGTLVSTDNYFNLQLNEAEEFVAGV
SHGTLGEIFIRCNNVLYIRE
3D structure
PDB7dco Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
Chainj
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna j K32 Y48 R74 K21 Y35 R61
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Nov 25 15:45:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7dco', asym_id = 'j', title = 'Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7dco', asym_id='j', title='Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0000387,0000398,0003723,0005681', uniprot = '', pdbid = '7dco', asym_id = 'j'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000387,0000398,0003723,0005681', uniprot='', pdbid='7dco', asym_id='j')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>