Structure of PDB 7d1t Chain j

Receptor sequence
>7d1tj (length=36) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
GGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
3D structure
PDB7d1t High-resolution cryo-EM structure of photosystem II reveals damage from high-dose electron beams.
Chainj
Resolution1.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide j W11 I12 W7 I8
BS02 MG j G31 A34 L36 G27 A30 L32
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7d1t, PDBe:7d1t, PDBj:7d1t
PDBsum7d1t
PubMed33753866
UniProtQ7DGD4|PSBJ_THEVL Photosystem II reaction center protein J (Gene Name=psbJ)

[Back to BioLiP]