Structure of PDB 7bt6 Chain j

Receptor sequence

>7bt6j (length=77) Species: 559292 (Saccharomyces cerevisiae S288C)

GNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKRRHTTGT
GRMRYLKHVSRRFKNGFQTGSASKASA

3D structure

• PDB: 7bt6 Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
• Chain: j
• Resolution: 3.12 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	G2 N13 S15 H16 R24 R25 S26 H28 Q30 S35 A42 K43 R45 Y47 N48 W49 K52 R56 T59	G1 N2 S4 H5 R13 R14 S15 H17 Q19 S24 A31 K32 R34 Y36 N37 W38 K41 R45 T48
BS02	rna	j	N13 R21 C22 G23 T59 G62 R63 M64 Y66 K68 R72 F74 K75 N76 Q79 T80 G81 S82 A83 K85 A88	N2 R10 C11 G12 T48 G51 R52 M53 Y55 K57 R61 F63 K64 N65 Q68 T69 G70 S71 A72 K74 A77
BS03	ZN	j	C19 C34	C8 C23

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7bt6, PDBe:7bt6, PDBj:7bt6
• PDBsum: 7bt6
• PubMed: 33037216
• UniProt: P49166|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)