Structure of PDB 7aso Chain j

Receptor sequence

>7asoj (length=60) Species: 1280 (Staphylococcus aureus)

PKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVS
KSDMKRVKQL

3D structure

• PDB: 7aso Staphylococcus aureus 70S after 30 minutes incubation a 37C
• Chain: j
• Resolution: 3.11 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	P2 K3 M4 K5 R8 S25 R26 F28 N35 K36 M55 V58 K59	P1 K2 M3 K4 R7 S24 R25 F27 N34 K35 M54 V57 K58

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 00:16:34 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7aso', asym_id = 'j', title = 'Staphylococcus aureus 70S after 30 minutes incubation a 37C'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7aso', asym_id='j', title='Staphylococcus aureus 70S after 30 minutes incubation a 37C')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7aso', asym_id = 'j'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7aso', asym_id='j')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>