Structure of PDB 6zxg Chain j

Receptor sequence
>6zxgj (length=116) Species: 9606 (Homo sapiens) [Search protein sequence]
SQATKRKHVVKEVLGEHIVPSDQQQIVRVLRTPGNNLHEVETAQGQRFLV
SMPSKYRKNIWIKRGDFLIVDPIEEGEKVKAEISFVLCKDHVRSLQKEGF
WPEAFSEDDSDLFVNT
3D structure
PDB6zxg Structural basis for the final steps of human 40S ribosome maturation.
Chainj
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j S2 T5 K6 K8 P34 G35 N36 N37 M53 S55 Y57 R58 K59 I61 W62 I63 K79 D140 S1 T4 K5 K7 P33 G34 N35 N36 M52 S54 Y56 R57 K58 I60 W61 I62 K78 D109
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
Biological Process
GO:0006413 translational initiation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005829 cytosol
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zxg, PDBe:6zxg, PDBj:6zxg
PDBsum6zxg
PubMed33208940
UniProtQ8N9N8|EIF1A_HUMAN Probable RNA-binding protein EIF1AD (Gene Name=EIF1AD)

[Back to BioLiP]