Structure of PDB 6zkd Chain j |
>6zkdj (length=82) Species: 9940 (Ovis aries) [Search protein sequence] |
PLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAM EDEFGFEIPDIDAEKLMCPQEIVDYIADKKDV |
|
PDB | 6zkd The coupling mechanism of mammalian respiratory complex I. |
Chain | j |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZMP |
j |
S44 L45 |
S40 L41 |
|
|
|
|