Structure of PDB 6yly Chain j

Receptor sequence

>6ylyj (length=81) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

PSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKR
RHTTGTGRMRYLKHVSRRFKNGFQTGSASKA

3D structure

PDB

6yly Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.

Chain

Resolution

3.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	j	P6 S7 F8 G9 K10 R11 H12 N13 S15 H16 R24 R25 S26 H28 Q30 S35 K43 R45 Y47 N48 W49 K52 R55 R56 K75	P1 S2 F3 G4 K5 R6 H7 N8 S10 H11 R19 R20 S21 H23 Q25 S30 K38 R40 Y42 N43 W44 K47 R50 R51 K70
BS02	rna	j	R21 C22 G23 Y39 T59 G62 R63 M64 R65 Y66 R72 F74 K75 N76 Q79 G81 S82 A83 K85	R16 C17 G18 Y34 T54 G57 R58 M59 R60 Y61 R67 F69 K70 N71 Q74 G76 S77 A78 K80
BS03	ZN	j	C19 C22 C37	C14 C17 C32

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6yly, PDBe:6yly, PDBj:6yly
PDBsum	6yly
PubMed	32668200
UniProt	P49166\|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)