Structure of PDB 6yam Chain j

Receptor sequence

>6yamj (length=109) Species: 9986 (Oryctolagus cuniculus)

KGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVK
RLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAY
GELPEHAKI

3D structure

• PDB: 6yam Structural Insights into the Mammalian Late-Stage Initiation Complexes.
• Chain: j
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	G8 K10	G2 K4
BS02	rna	j	K10 N11 R14 G15 K16 N17 L42 G43 N44 R46 G63 K64 R66 K67 V69 W70	K4 N5 R8 G9 K10 N11 L36 G37 N38 R40 G57 K58 R60 K61 V63 W64
BS03	rna	j	K7 K10 K16 K67 K68 W70	K1 K4 K10 K61 K62 W64

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 00:51:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6yam', asym_id = 'j', title = 'Structural Insights into the Mammalian Late-Stage Initiation Complexes.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6yam', asym_id='j', title='Structural Insights into the Mammalian Late-Stage Initiation Complexes.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003743,0006413', uniprot = '', pdbid = '6yam', asym_id = 'j'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003743,0006413', uniprot='', pdbid='6yam', asym_id='j')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>