Structure of PDB 6v3e Chain j

Receptor sequence

>6v3ej (length=100) Species: 1960940 (Acinetobacter sp. ANC 5600)

NQRIRIRLKSFDHRLIDQSAQEIVETAKRTGAQVCGPIPMPTRIERFNVL
TSPHVNKDARDQYEIRTYKRLIDIVQPTDKTVDALMKLDLAAGVDVQIAL

3D structure

• PDB: 6v3e Cryo-electron Microscopy Structure of the Acinetobacter baumannii 70S Ribosome and Implications for New Antibiotic Development.
• Chain: j
• Resolution: 4.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	R7 R9 K11 H15 C37 P39 I40 P41 M42 P43 R45 N50 T53 S54 P55 H56 V57 N58 K59 A61 R62 Y70 K71 R72	R5 R7 K9 H13 C35 P37 I38 P39 M40 P41 R43 N48 T51 S52 P53 H54 V55 N56 K57 A59 R60 Y68 K69 R70

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 01:42:54 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6v3e', asym_id = 'j', title = 'Cryo-electron Microscopy Structure of the Acinet... and Implications for New Antibiotic Development.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6v3e', asym_id='j', title='Cryo-electron Microscopy Structure of the Acinet... and Implications for New Antibiotic Development.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412', uniprot = '', pdbid = '6v3e', asym_id = 'j'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412', uniprot='', pdbid='6v3e', asym_id='j')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>