Structure of PDB 6sjj Chain j

Receptor sequence
>6sjjj (length=159) Species: 65561 (Hypericum perforatum) [Search protein sequence]
MAAYTIVKEEESPIAPHRLFKALVLERHQVLVKAQPHVFKSGEIIEGDGG
VGTVTKITFVDGHPLTYMLHKFDEIDAANFYCKYTLFEGDVLRDNIEKVV
YEVKLEAVGGGSKGKITVTYHPKPGCTVNEEEVKIGEKKAYEFYKQVEEY
LAANPEVFA
3D structure
PDB6sjj A new modulated crystal structure of the ANS complex of the St John's wort Hyp-1 protein with 36 protein molecules in the asymmetric unit of the supercell.
Chainj
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 2AN j H17 A77 H17 A77
BS02 2AN j E46 G47 E46 G47
BS03 2AN j R27 F39 F59 M68 L86 V91 K139 R27 F39 F59 M68 L86 V91 K139
BS04 2AN j K8 E10 L19 L23 V103 I116 Y144 K8 E10 L19 L23 V103 I116 Y144
BS05 2AN j V30 K33 A34 Y150 V157 V30 K33 A34 Y150 V157
BS06 2AN j L65 V91 E132 I135 L65 V91 E132 I135
Gene Ontology
Molecular Function
GO:0004864 protein phosphatase inhibitor activity
GO:0010427 abscisic acid binding
GO:0038023 signaling receptor activity
Biological Process
GO:0006952 defense response
GO:0009738 abscisic acid-activated signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6sjj, PDBe:6sjj, PDBj:6sjj
PDBsum6sjj
PubMed32627738
UniProtA0A160HRF0

[Back to BioLiP]