Structure of PDB 6r86 Chain j

Receptor sequence
>6r86j (length=119) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSI
ACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVT
EKQRKKQIAFPQRKYAIKA
3D structure
PDB6r86 Structure and function of Vms1 and Arb1 in RQC and mitochondrial proteome homeostasis.
Chainj
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j K5 A6 Y7 R10 K49 A52 C53 L55 T56 N59 R63 R67 K78 R81 A82 K83 T85 R86 R89 K4 A5 Y6 R9 K48 A51 C52 L54 T55 N58 R62 R66 K77 R80 A81 K82 T84 R85 R88
BS02 rna j G72 Y75 R81 R86 R90 T93 K94 F95 E96 K103 K106 G71 Y74 R80 R85 R89 T92 K93 F94 E95 K102 K105
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6r86, PDBe:6r86, PDBj:6r86
PDBsum6r86
PubMed31189955
UniProtP0CX84|RL35A_YEAST Large ribosomal subunit protein uL29A (Gene Name=RPL35A)

[Back to BioLiP]