Structure of PDB 6jlm Chain j

Receptor sequence
>6jlmj (length=39) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
MSEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
3D structure
PDB6jlm An oxyl/oxo mechanism for oxygen-oxygen coupling in PSII revealed by an x-ray free-electron laser.
Chainj
Resolution2.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG j G30 A33 G34 L35 G30 A33 G34 L35
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6jlm, PDBe:6jlm, PDBj:6jlm
PDBsum6jlm
PubMed31624207
UniProtQ7DGD4|PSBJ_THEVL Photosystem II reaction center protein J (Gene Name=psbJ)

[Back to BioLiP]