Structure of PDB 6fyy Chain j

Receptor sequence
>6fyyj (length=249) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELS
RRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKY
QKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDE
TVWEGIEPPSKDVLDELKNYISVKIRADVEVSCFSYEGIDAIKDALKSAE
DVKVKLVAAPLYVLTTQALDKQKGIEQLESAIEKITEVITKYGGVCNIT
3D structure
PDB6fyy Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
Chainj
Resolution3.02 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j R57 S58 Q60 K61 R64 Q103 R113 Y114 K118 Y172 V223 R55 S56 Q58 K59 R62 Q101 R111 Y112 K116 Y170 V207
BS02 rna j R53 Q60 R88 R51 Q58 R86
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0043022 ribosome binding
GO:1990856 methionyl-initiator methionine tRNA binding
Biological Process
GO:0001731 formation of translation preinitiation complex
GO:0006412 translation
GO:0006413 translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005850 eukaryotic translation initiation factor 2 complex
GO:0010494 cytoplasmic stress granule
GO:0033290 eukaryotic 48S preinitiation complex
GO:0043614 multi-eIF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fyy, PDBe:6fyy, PDBj:6fyy
PDBsum6fyy
PubMed30475211
UniProtP20459|IF2A_YEAST Eukaryotic translation initiation factor 2 subunit alpha (Gene Name=SUI2)

[Back to BioLiP]