Structure of PDB 6em3 Chain j

Receptor sequence
>6em3j (length=71) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKRRHTTGTGRM
RYLKHVSRRFKNGFQTGSASK
3D structure
PDB6em3 Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
Chainj
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j S35 K43 Y47 N48 W49 S21 K29 Y33 N34 W35
BS02 rna j R21 C22 G23 T59 G60 G62 M64 R65 Y66 L67 G81 R7 C8 G9 T45 G46 G48 M50 R51 Y52 L53 G67
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6em3, PDBe:6em3, PDBj:6em3
PDBsum6em3
PubMed29245012
UniProtP49166|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)

[Back to BioLiP]