Structure of PDB 6az3 Chain j

Receptor sequence

>6az3j (length=80) Species: 5661 (Leishmania donovani)

TKGTTSMGQRHGRTHILCRRCGRNSYHVQWERCAACAYPRASRRRYNWSV
KAIKRRRTGTGRCRYLKVVNRRIANHFKTP

3D structure

• PDB: 6az3 Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.
• Chain: j
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	K3 G4 T5 M8 Q10 R11 H12 G13 R14 T15 H16 R24 S26 H28 Q30 W31 R33 A35 R41 A42 R45 R46 Y47 N48 W49 S50 V51 K52 R56 R58 T59 H77 F78 K79	K2 G3 T4 M7 Q9 R10 H11 G12 R13 T14 H15 R23 S25 H27 Q29 W30 R32 A34 R40 A41 R44 R45 Y46 N47 W48 S49 V50 K51 R55 R57 T58 H76 F77 K78
BS02	rna	j	T2 K3 T5 T6 M8 G9 Q10	T1 K2 T4 T5 M7 G8 Q9
BS03	rna	j	I17 R20 R21 G23 Y39 R44 T59 G60 G62 R63 C64 R65 Y66 L67 R72 R73 I74 N76 H77 K79 T80 P81	I16 R19 R20 G22 Y38 R43 T58 G59 G61 R62 C63 R64 Y65 L66 R71 R72 I73 N75 H76 K78 T79 P80

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6az3, PDBe:6az3, PDBj:6az3
• PDBsum: 6az3
• PubMed: 29150609
• UniProt: P62885|RL37_LEIDO Large ribosomal subunit protein eL37 (Gene Name=RPL37)