Structure of PDB 5nrl Chain j

Receptor sequence
>5nrlj (length=74) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MLPLYLLTNAKGQQMQIELKNGEIIQGILTNVDNWMNLTLSNVTEYSVKL
NEIYIRGTFIKFIKLQDNIIDKVK
3D structure
PDB5nrl Structure of a pre-catalytic spliceosome.
Chainj
Resolution7.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j W35 N37 R72 T74 W35 N37 R56 T58
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0017070 U6 snRNA binding
Biological Process
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006364 rRNA processing
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008033 tRNA processing
GO:0008380 RNA splicing
GO:0033962 P-body assembly
GO:0042149 cellular response to glucose starvation
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005688 U6 snRNP
GO:0005730 nucleolus
GO:0005732 sno(s)RNA-containing ribonucleoprotein complex
GO:0005737 cytoplasm
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071001 U4/U6 snRNP
GO:0097525 spliceosomal snRNP complex
GO:0097526 spliceosomal tri-snRNP complex
GO:1990726 Lsm1-7-Pat1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nrl, PDBe:5nrl, PDBj:5nrl
PDBsum5nrl
PubMed28530653
UniProtP40070|LSM4_YEAST U6 snRNA-associated Sm-like protein LSm4 (Gene Name=LSM4)

[Back to BioLiP]