Structure of PDB 5gak Chain j

Receptor sequence
>5gakj (length=119) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSI
ACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVT
EKQRKKQIAFPQRKYAIKA
3D structure
PDB5gak Structure of the hypusinylated eukaryotic translation factor eIF-5A bound to the ribosome.
Chainj
Resolution3.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j Y75 R86 R90 T93 K94 F95 E96 E102 K103 K106 K115 Y74 R85 R89 T92 K93 F94 E95 E101 K102 K105 K114
BS02 rna j K5 A6 Y7 R10 K43 K49 A52 T56 N59 R63 K78 T85 R86 R89 K4 A5 Y6 R9 K42 K48 A51 T55 N58 R62 K77 T84 R85 R88
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gak, PDBe:5gak, PDBj:5gak
PDBsum5gak
PubMed26715760
UniProtP0CX84|RL35A_YEAST Large ribosomal subunit protein uL29A (Gene Name=RPL35A)

[Back to BioLiP]