Structure of PDB 3jcs Chain j

Receptor sequence

>3jcsj (length=78) Species: 5661 (Leishmania donovani)

TKGTTSMGQRHGRTHILCRRCGRNSYHVQWERCAACAYPRASRRRYNWSV
KAIKRRRTGTGRCRYLKVVNRRIANHFK

3D structure

• PDB: 3jcs 2.8- angstrom Cryo-EM Structure of the Large Ribosomal Subunit from the Eukaryotic Parasite Leishmania.
• Chain: j
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	j	T2 K3 G4 T5 T6 S7 Q10 R11 H12 G13 R14 T15 H16 R24 S26 H28 Q30 R33 A35 A36 R41 A42 S43 R45 R46 Y47 N48 W49 S50 K52 A53 R56 R57 R58 N71	T1 K2 G3 T4 T5 S6 Q9 R10 H11 G12 R13 T14 H15 R23 S25 H27 Q29 R32 A34 A35 R40 A41 S42 R44 R45 Y46 N47 W48 S49 K51 A52 R55 R56 R57 N70
BS02	rna	j	T2 K3 T5 T6 M8 G9 Q10 H12	T1 K2 T4 T5 M7 G8 Q9 H11
BS03	rna	j	I17 R20 R21 C22 G23 Y39 A42 R44 T59 G60 G62 R63 C64 R65 Y66 L67 R72 R73 I74	I16 R19 R20 C21 G22 Y38 A41 R43 T58 G59 G61 R62 C63 R64 Y65 L66 R71 R72 I73

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jcs, PDBe:3jcs, PDBj:3jcs
• PDBsum: 3jcs
• PubMed: 27373148
• UniProt: P62885|RL37_LEIDO Large ribosomal subunit protein eL37 (Gene Name=RPL37)