Structure of PDB 3j81 Chain j

Receptor sequence
>3j81j (length=252) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELS
RRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKY
QKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDE
TVWEGIEPPSKDVLDELKNYISAVKIRADVEVSCFSYEGIDAIKDALKSA
EDMSVKVKLVAAPLYVLTTQALDKQKGIEQLESAIEKITEVITKYGGVCN
IT
3D structure
PDB3j81 Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
Chainj
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna j R53 Q60 R51 Q58
BS02 rna j S58 Q60 K61 R64 G66 K67 N68 Y102 Q103 K106 T107 S110 R113 Y114 K118 Y172 V223 A224 S56 Q58 K59 R62 G64 K65 N66 Y100 Q101 K104 T105 S108 R111 Y112 K116 Y170 V210 A211
BS03 rna j R55 R57 R53 R55
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0043022 ribosome binding
GO:1990856 methionyl-initiator methionine tRNA binding
Biological Process
GO:0001731 formation of translation preinitiation complex
GO:0006412 translation
GO:0006413 translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005850 eukaryotic translation initiation factor 2 complex
GO:0010494 cytoplasmic stress granule
GO:0033290 eukaryotic 48S preinitiation complex
GO:0043614 multi-eIF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j81, PDBe:3j81, PDBj:3j81
PDBsum3j81
PubMed25417110
UniProtP20459|IF2A_YEAST Eukaryotic translation initiation factor 2 subunit alpha (Gene Name=SUI2)

[Back to BioLiP]