Structure of PDB 8scb Chain ii

Receptor sequence

>8scbii (length=416) Species: 9606 (Homo sapiens) [Search protein sequence]

SAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADE
FGTASNIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEG
KEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALLSDDSKFGFIVIDGSG
ALFGTLQGNTREVLHKFTVDLPKKHGRAAQSALRFARLRMEKRHNYVRKV
AETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVD
ISYGGENGFNQAIELSTEVLSNVKFIQEKKLIGRYFDEISQDTGKYCFGV
EDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKS
HFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKG
FGGIGGILRYRVDFQG

3D structure

PDB

8scb Structure and consequences of eRF1 glued to the ribosomal decoding center

Chain

Resolution

2.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	ii	S46 K50 K83	S41 K45 K78
BS02	rna	ii	R47 N121 T122 S123 Y125 G153 R166 K178 K179 H180 G181 R182 A184 Q185 L188 R189 F190 R192 L193 E196 R198 S229 A230 S257 Y258 M314 G315 F385 G386 Y415	R42 N116 T117 S118 Y120 G148 R161 K173 K174 H175 G176 R177 A179 Q180 L183 R184 F185 R187 L188 E191 R193 S224 A225 S252 Y253 M309 G310 F380 G381 Y410
BS03	rna	ii	R65 Q80 L126 C127	R60 Q75 L121 C122
BS04	rna	ii	T32 T58 N61 I62 K63 V71 C127	T27 T53 N56 I57 K58 V66 C122
BS05	ZVM	ii	L37 R47 M51 E55 S123 L124 Y125	L32 R42 M46 E50 S118 L119 Y120

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003747	translation release factor activity
GO:0004045	aminoacyl-tRNA hydrolase activity
GO:0005515	protein binding
GO:0008079	translation termination factor activity
GO:0016149	translation release factor activity, codon specific
GO:0043022	ribosome binding
GO:1990825	sequence-specific mRNA binding

	Biological Process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0002184	cytoplasmic translational termination
GO:0006412	translation
GO:0006415	translational termination
GO:0006449	regulation of translational termination
GO:0006479	protein methylation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0018444	translation release factor complex
GO:0022626	cytosolic ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8scb, PDBe:8scb, PDBj:8scb
PDBsum	8scb
PubMed	38172604
UniProt	P62495\|ERF1_HUMAN Eukaryotic peptide chain release factor subunit 1 (Gene Name=ETF1)

[Back to BioLiP]