Structure of PDB 5lzu Chain ii
Receptor sequence
| >5lzuii (length=418) Species: 9606 (Homo sapiens) [Search protein sequence] |
| SAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADE FGTASNIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEG KEKKVNIDFEPFKPINTSLYLCDNKFHTEALTALLSDDSKFGFIVIDGSG ALFGTLQGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKV AETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQRLQSKVLKLVD ISYGGENGFNQAIELSTEVLSNVKFIQEKKLIGRYFDEISQDTGKYCFGV EDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKS HFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKG FGGIGGILRYRVDFQGME |
3D structure
| PDB | 5lzu Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes. | ||
| Chain | ii | ||
| Resolution | 3.75 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | rna | ii | S46 K50 K83 D175 | S41 K45 K78 D170 | |
| BS02 | rna | ii | K42 N121 S123 D152 G153 R166 K178 K179 H180 R182 G184 Q185 R189 F190 R192 E196 S229 F232 D255 S257 Y258 S295 F385 R414 Y415 | K37 N116 S118 D147 G148 R161 K173 K174 H175 R177 G179 Q180 R184 F185 R187 E191 S224 F227 D250 S252 Y253 S290 F380 R409 Y410 | |
| BS03 | rna | ii | R65 Q80 C127 | R60 Q75 C122 | |
| BS04 | rna | ii | T32 E55 N61 I62 K63 N67 V71 C127 | T27 E50 N56 I57 K58 N62 V66 C122 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0003723 | RNA binding |
| GO:0003747 | translation release factor activity |
| GO:0004045 | aminoacyl-tRNA hydrolase activity |
| GO:0005515 | protein binding |
| GO:0008079 | translation termination factor activity |
| GO:0016149 | translation release factor activity, codon specific |
| GO:0043022 | ribosome binding |
| GO:1990825 | sequence-specific mRNA binding |
