Structure of PDB 5m1j Chain i5

Receptor sequence
>5m1ji5 (length=99) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
TVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLS
PYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH
3D structure
PDB5m1j Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.
Chaini5
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i5 K13 V17 K25 I26 Y28 K29 K30 G31 A32 S34 R41 Y53 R62 R68 K71 K74 K75 R76 L77 G78 F80 R82 K84 E89 R98 K12 V16 K24 I25 Y27 K28 K29 G30 A31 S33 R40 Y52 R61 R67 K70 K73 K74 R75 L76 G77 F79 R81 K83 E88 R97
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5m1j, PDBe:5m1j, PDBj:5m1j
PDBsum5m1j
PubMed27995908
UniProtP05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)

[Back to BioLiP]