Structure of PDB 6t59 Chain i3

Receptor sequence
>6t59i3 (length=102) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
ALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFA
PYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSSVLAAMRKAA
AK
3D structure
PDB6t59 TTC5 mediates autoregulation of tubulin via mRNA degradation.
Chaini3
Resolution3.11 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i3 R4 H15 V17 R25 H26 S27 R28 R29 R30 G31 L33 T34 H36 R41 Y53 E59 K67 R68 K74 R76 H80 R82 R85 K86 R3 H14 V16 R24 H25 S26 R27 R28 R29 G30 L32 T33 H35 R40 Y52 E58 K66 R67 K73 R75 H79 R81 R84 K85
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6t59, PDBe:6t59, PDBj:6t59
PDBsum6t59
PubMed31727855
UniProtG1TTQ5|RL36_RABIT Large ribosomal subunit protein eL36 (Gene Name=RPL36)

[Back to BioLiP]