Structure of PDB 7oya Chain i2

Receptor sequence
>7oyai2 (length=36) Species: 7955 (Danio rerio) [Search protein sequence]
KREFERHSGSDRSSVRSEEKRSGSGSRNWGSVRDHM
3D structure
PDB7oya A molecular network of conserved factors keeps ribosomes dormant in the egg.
Chaini2
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i2 K187 F190 E191 R192 R198 S199 V201 R202 K206 R207 S210 G211 R213 K1 F4 E5 R6 R12 S13 V15 R16 K20 R21 S24 G25 R27
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0043022 ribosome binding
GO:0061770 translation elongation factor binding
Biological Process
GO:0006417 regulation of translation
GO:0033120 positive regulation of RNA splicing
GO:0045948 positive regulation of translational initiation
GO:0141014 ribosome hibernation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0010494 cytoplasmic stress granule
GO:0015030 Cajal body
GO:0016607 nuclear speck

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oya, PDBe:7oya, PDBj:7oya
PDBsum7oya
PubMed36653451
UniProtQ5XJA5|HABP4_DANRE Intracellular hyaluronan-binding protein 4 (Gene Name=habp4)

[Back to BioLiP]