Structure of PDB 7r81 Chain i1

Receptor sequence

>7r81i1 (length=108) Species: 5141 (Neurospora crassa) [Search protein sequence]

ASSRVTYRRRNPYNTTSNKTRIVKTPGGQLRVLHIKKRGTAPKCGDCGIK
LPGVPALRPREYAQLSKPKKTVQRAYGGSRCGNCVRDRVVRAFLIEEQKI
VKKVLKEQ

3D structure

PDB

7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i1	A2 R5 V6 R9 R10 R11 N12 P13 Y14 N15 T16 T17 S18 R22 K25 T26 P27 G28 L31 R32 K37 K38 R39 T41 K44 P53 G54 V55 A57 R59 P60 R61 A64 S67 K68 P69 K71 T72 Q74 R75 A76 Y77 G79 N84 R89 R92 A93 I96 K103 K107	A1 R4 V5 R8 R9 R10 N11 P12 Y13 N14 T15 T16 S17 R21 K24 T25 P26 G27 L30 R31 K36 K37 R38 T40 K43 P52 G53 V54 A56 R58 P59 R60 A63 S66 K67 P68 K70 T71 Q73 R74 A75 Y76 G78 N83 R88 R91 A92 I95 K102 K106

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links