Structure of PDB 7piw Chain i1

Receptor sequence
>7piwi1 (length=35) Species: 3046 (Dunaliella salina) [Search protein sequence]
MLTLKIFVYTVVTFFVGLFIFGFLSNDPSRNPGKG
3D structure
PDB7piw Structure of Dunaliella Photosystem II reveals conformational flexibility of stacked and unstacked supercomplexes.
Chaini1
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ERG i1 L2 I6 L2 I6
BS02 CLA i1 V8 Y9 V12 F15 V8 Y9 V12 F15
BS03 CLA i1 F19 F23 F19 F23
BS04 4RF i1 T3 F7 T10 F14 T3 F7 T10 F14
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7piw, PDBe:7piw, PDBj:7piw
PDBsum7piw
PubMed36799903
UniProtD0FXX5

[Back to BioLiP]