Structure of PDB 7oya Chain i1

Receptor sequence
>7oyai1 (length=98) Species: 7955 (Danio rerio) [Search protein sequence]
VRYPMAVGLNKGHKVTKNVSKPKHSRRRGRLTKHAKFARDLIREVCGFAP
YERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNTLAAMRKA
3D structure
PDB7oya A molecular network of conserved factors keeps ribosomes dormant in the egg.
Chaini1
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i1 G14 H15 V17 K25 H26 S27 R28 R29 R30 G31 L33 T34 H36 R41 Y53 K67 R68 R76 I81 R82 K84 G12 H13 V15 K23 H24 S25 R26 R27 R28 G29 L31 T32 H34 R39 Y51 K65 R66 R74 I79 R80 K82
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0007420 brain development
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oya, PDBe:7oya, PDBj:7oya
PDBsum7oya
PubMed36653451
UniProtQ6Q415|RL36_DANRE Large ribosomal subunit protein eL36 (Gene Name=rpl36)

[Back to BioLiP]