Structure of PDB 8wid Chain i

Receptor sequence
>8widi (length=131) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
TMTDPIADFLTRLRNANSAYHDEVTLPHSKLKANIAEILKREGYISDYRT
EDARVGKSLVVQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGGL
GVAIISTSSGLLTDRQAARQGVGGEVLAYVW
3D structure
PDB8wid Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chaini
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i T2 T4 T12 R13 R15 N16 H22 S30 K31 R55 V56 K82 P83 R86 Y88 K90 S91 S107 T108 S109 G122 G124 T1 T3 T11 R12 R14 N15 H21 S29 K30 R54 V55 K81 P82 R85 Y87 K89 S90 S106 T107 S108 G121 G123
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wid, PDBe:8wid, PDBj:8wid
PDBsum8wid
PubMed38245551
UniProtA0QSG3|RS8_MYCS2 Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]