Structure of PDB 8v84 Chain i

Receptor sequence

>8v84i (length=84) Species: 1247190 (Saccharomyces cerevisiae BY4741)

VTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGE
KRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH

3D structure

• PDB: 8v84 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.
• Chain: i
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	K25 S27 Y28 K29 K30 G31 A32 A33 S34 R36 R41 Y53 R76 L77 R82	K9 S11 Y12 K13 K14 G15 A16 A17 S18 R20 R25 Y37 R60 L61 R66

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8v84, PDBe:8v84, PDBj:8v84
• PDBsum: 8v84
• PubMed: 38632236
• UniProt: P05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)