Structure of PDB 8uu6 Chain i

Receptor sequence

>8uu6i (length=125) Species: 1642 (Listeria innocua)

QYYGTGRRKSSVARVRLVPGDGKIVINNRDWEDYIPFAALREVIKQPLVA
TETLGNYDVLVNVHGGGYTGQAGAIRHGVARALLQVAPEYRPALKSAGLL
TRDPRMKERKKYGLKGARRAPQFSK

3D structure

• PDB: 8uu6 Mechanistic insights into the alternative ribosome recycling by HflXr.
• Chain: i
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	R11 R12 K13 S14 R18 R20 H68 G69 G70 G71 Y72 T73 R95 T105 R106 R109 M110 K111 E112 R113 K114 K115 Y116 K119 R122 R123 Q126 F127 K129	R7 R8 K9 S10 R14 R16 H64 G65 G66 G67 Y68 T69 R91 T101 R102 R105 M106 K107 E108 R109 K110 K111 Y112 K115 R118 R119 Q122 F123 K125

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8uu6, PDBe:8uu6, PDBj:8uu6
• PDBsum: 8uu6
• PubMed: 38407413
• UniProt: A0A0U5ADS9