Structure of PDB 8qpp Chain i

Receptor sequence

>8qppi (length=146) Species: 1423 (Bacillus subtilis)

MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGGVRPGF
EGGQMPLFQRLPKRGFTNINRKEYAVVNLDKLNGFAEGTEVTPELLLETG
VISKLNAGVKILGNGKLEKKLTVKANKFSASAKEAVEAAGGTAEVI

3D structure

• PDB: 8qpp An evolutionarily conserved strategy for ribosome binding and inhibition by beta-coronavirus non-structural protein 1
• Chain: i
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	L3 H4 L6 K7 S9 G11 S12 R13 K14 R16 N17 R18 V19 G20 R21 G22 G24 G28 K29 T30 A31 G32 K33 G34 H35 K36 G37 Q38 N39 R41 S42 G43 R47 F50 E51 G52 G53 Q54 M55 Q59 R60 L61 P62 K63 R64 G65 F66 N68 N70 R71 N78 K81 S103 K104 K110 L112 G113 N114 S129 A130 S131	L3 H4 L6 K7 S9 G11 S12 R13 K14 R16 N17 R18 V19 G20 R21 G22 G24 G28 K29 T30 A31 G32 K33 G34 H35 K36 G37 Q38 N39 R41 S42 G43 R47 F50 E51 G52 G53 Q54 M55 Q59 R60 L61 P62 K63 R64 G65 F66 N68 N70 R71 N78 K81 S103 K104 K110 L112 G113 N114 S129 A130 S131

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8qpp, PDBe:8qpp, PDBj:8qpp
• PDBsum: 8qpp
• PubMed: 38177497
• UniProt: A0A063XCP1