Structure of PDB 8p2f Chain i

Receptor sequence
>8p2fi (length=131) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
TMTDPIADMLTRVRNANMVRHEKLELPASNIKKEIAEILKSEGFIKNVEY
VEDDKQGVLRLFLKYGQNDERVITGLKRISKPGLRVYAKASEMPKVLNGL
GIALVSTSEGVITDKEARKRNVGGEIIAYVW
3D structure
PDB8p2f Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
Chaini
Resolution2.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna i T2 M3 T4 D9 T12 R13 R15 N16 H22 N31 K56 Q57 K82 P83 G84 Y88 K90 A91 S107 T108 S109 N122 G124 E126 T1 M2 T3 D8 T11 R12 R14 N15 H21 N30 K55 Q56 K81 P82 G83 Y87 K89 A90 S106 T107 S108 N121 G123 E125
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p2f, PDBe:8p2f, PDBj:8p2f
PDBsum8p2f
PubMed38902339
UniProtQ2FW20|RS8_STAA8 Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]