Structure of PDB 8oeq Chain i

Receptor sequence

>8oeqi (length=121) Species: 5476 (Candida albicans)

KNTSSKKSDAAPASADPAKAKKKKSPTGNEAALKNKNFNKDVAPPQSTAT
KHSKKPFDRHSRTGKTDSKKKLQQGWGQSDKRELEGEVEGTEDAEAELEA
EAEENDESYLAELELSKQELE

3D structure

• PDB: 8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
• Chain: i
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	K37 K38 S39 D40 P48 K50 K52 K55 S56 P57	K6 K7 S8 D9 P17 K19 K21 K24 S25 P26
BS02	rna	i	A74 P75 P76 Q77 A80 T81 K82 K85 D89 R90 H91 S92 R93 G95 K96 T97 S99 K100 K101 K102 Q105 R113	A43 P44 P45 Q46 A49 T50 K51 K54 D58 R59 H60 S61 R62 G64 K65 T66 S68 K69 K70 K71 Q74 R82

External links

• PDB: RCSB:8oeq, PDBe:8oeq, PDBj:8oeq
• PDBsum: 8oeq
• UniProt: A0A1D8PK71|STM1_CANAL Ribosome-associated protein STM1 (Gene Name=STM1)