Structure of PDB 8fzd Chain i

Receptor sequence

>8fzdi (length=127) Species: 562 (Escherichia coli)

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

• PDB: 8fzd The ribosome termination complex remodels release factor RF3 and ejects GDP.
• Chain: i
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	i	Q5 Y7 R11 K13 S14 R18 G69 G71 I72 S73 Q75 R85 R99 T105 R106 R109 Q110 V111 E112 R113 K114 K115 R119 K120 R122 R123 R124 Q126 F127 K129	Q2 Y4 R8 K10 S11 R15 G66 G68 I69 S70 Q72 R82 R96 T102 R103 R106 Q107 V108 E109 R110 K111 K112 R116 K117 R119 R120 R121 Q123 F124 K126
BS02	rna	i	K129 R130	K126 R127

External links

• PDB: RCSB:8fzd, PDBe:8fzd, PDBj:8fzd
• PDBsum: 8fzd
• PubMed: 39030416